Cosrx The 6 Peptide Skin Booster

COSRX

Cosrx The 6 Peptide Skin Booster

$16.99

lightweightwaterymilkyslipperyviscousserum like
1

This lightweight, watery multi-action serum is designed as the first step after cleansing to prep skin for easy layering. A six-peptide complex, niacinamide, sodium hyaluronate and allantoin help moisturize while improving the look of elasticity, texture, pores, dullness and uneven tone. Suitable for all skin types, including sensitive skin, its slippery, milky texture absorbs quickly without feeling heavy.

Community highlights

Where it lands best

  • hyperpigmentation + ages 35+

    Community favorite
  • ages 35+

    Community favorite
  • White / Caucasian members + ages 35+

    Community favorite

Where it gets less love

  • oily skin + oiliness

    Less used here
  • sensitive skin + oily skin + acne

    Less used here
  • normal skin + oily skin + general

    Less used here

Staying power

High

Most people who try it are still using it a month later.

Community adoption

High

Widely tried across the Thea community.

How often it’s set aside

Low

Few of its users have shelved it.

Not sure this one fits your skin?

Scan your face in the Thea app and see how this product scores for your skin type, concerns, and routine.

Get the Thea app